SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000431051 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000431051
Domain Number - Region: 64-138
Classification Level Classification E-value
Superfamily Spectrin repeat 0.046
Family Spectrin repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000431051   Gene: ENSG00000164758   Transcript: ENST00000522839
Sequence length 143
Comment pep:novel chromosome:GRCh38:8:117520833:117539978:1 gene:ENSG00000164758 transcript:ENST00000522839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQL
PNGVTYHTGTYQDRLTKLQDNLRQLSVLFRKLRLVYDKCNENCGGMDPIPVEKLKQKNQQ
LKQIMDQLRNLIWDINAMLAMRN
Download sequence
Identical sequences A0A2I2Z4Z5 A0A2I3GGN1 A0A2I3N2N5 A0A2I3S9H3 A0A2J8X354 A0A2K5DLK4 A0A2K5HUL3 A0A2K5N1K3 A0A2K5RR72 A0A2K5UZU6 A0A2K6A5I5 A0A2K6BHE6 A0A2K6L7B3 A0A2K6P162 A0A2K6UM51 F6WWM4
NP_001269915.1.87134 NP_001269915.1.92137 XP_008975210.1.60992 XP_011796476.1.43180 XP_011821525.1.47321 XP_012362242.1.23891 XP_016815289.1.37143 ENSP00000431051 ENSP00000431051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]