SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000431225 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000431225
Domain Number 1 Region: 3-100
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000974
Family ABC transporter ATPase domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000431225   Gene: ENSG00000113522   Transcript: ENST00000533482
Sequence length 102
Comment pep:known chromosome:GRCh38:5:132556938:132642476:1 gene:ENSG00000113522 transcript:ENST00000533482 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MSRIEKMSILGVRSFGIEDKDKQIITFFSPLTILVGPNGAGKTTIIECLKYICTGDFPPG
TKGNTFVHDPKVAQETDVRAQIRLQFRDVNGELIAVQRSMAW
Download sequence
Identical sequences E9PM98
ENSP00000431225 ENSP00000431225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]