SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000431243 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000431243
Domain Number 1 Region: 108-185
Classification Level Classification E-value
Superfamily VPS28 C-terminal domain-like 6.02e-27
Family VPS28 C-terminal domain-like 0.00091
Further Details:      
 
Domain Number 2 Region: 18-95
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 5.89e-23
Family VPS28 N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000431243   Gene: ENSG00000160948   Transcript: ENST00000533806
Sequence length 185
Comment pep:putative chromosome:GRCh38:8:144423864:144428548:-1 gene:ENSG00000160948 transcript:ENST00000533806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDC
VSPSEQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKDDKGNLNRCIADVVSLFI
TVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTVSQWLQTLSGMSASDELD
DSQVR
Download sequence
Identical sequences A0A2J8PXF2 E9PM90
ENSP00000431243 ENSP00000456061 ENSP00000431243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]