SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000431323 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000431323
Domain Number 1 Region: 283-495
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.18e-58
Family DBL homology domain (DH-domain) 0.00014
Further Details:      
 
Domain Number 2 Region: 478-640
Classification Level Classification E-value
Superfamily PH domain-like 2.39e-34
Family Pleckstrin-homology domain (PH domain) 0.0019
Further Details:      
 
Domain Number 3 Region: 662-823
Classification Level Classification E-value
Superfamily PH domain-like 8.24e-23
Family Pleckstrin-homology domain (PH domain) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000431323   Gene: ENSG00000139132   Transcript: ENST00000531134
Sequence length 851
Comment pep:putative chromosome:GRCh38:12:32485972:32640739:1 gene:ENSG00000139132 transcript:ENST00000531134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGCSSTCPKIALVPPCSTSSTTTLVGENVSEEEAQGINGNRPAKHSAASPKPQVPPKPL
HLQNSPSSNIHQTPRHKALPSAKPRMEEIKPASASCVSKEKPSKVSDLISRFEGGSSLSN
YSDLKKESAVNLNAPRTPGRHGLTTTPQQKLLSQHLPQRQGNDTDKTQGAQTCVANGVMA
AQNQMECEEEKAATLSSDTSIQASEPLLDTHIVNGERDETATAPASPTTDSCDGNASDSS
YRTPGIGPVLPLEERGAETETKVQERENGESPLELEQLDQHHEMKETNEQKLHKIANELL
LTERAYVNRLDLLDQVFYCKLLEEANRGSFPAEMVNKIFSNISSINAFHSKFLLPELEKR
MQEWETTPRIGDILQKLAPFLKMYGEYVKGFDNAMELVKNMTERIPQFKSVVEEIQKQKI
CGSLTLQHHMLEPVQRIPRYEMLLKDYLRKLPPDSLDWNDAKKSLEIISTAASHSNSAIR
KMENLKKLLEIYEMLGEEEDIVNPSNELIKEGQILKLAARNTSAQERYLFLFNNMLLYCV
PKFSLVGSKFTVRTRVGIDGMKIVETQNEEYPHTFQVSGKERTLELQASSAQDKEEWIKA
LQETIDAFHQRHETFRNAIAKDNDIHSEVSTAELGKRAPRWIRDNEVTMCMKCKEPFNAL
TRRRHHCRACGYVVCWKCSDYKAQLEYDGGKLSKVCKDCYQIISGFTDSEEKKRKGILEI
ESAEVSGNSVVCSFLQYMEKSKPWQKAWCVIPKQDPLVLYMYGAPQDVRAQATIPLLGYV
VDEMPRSADLPHSFKLTQSKSVHSFAADSEELKQKWLKVILLAVTGETPGGPNEHPATLD
DHPEPKKKSEC
Download sequence
Identical sequences B7Z493
NP_001291410.1.87134 NP_001291410.1.92137 ENSP00000431323 ENSP00000431323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]