SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000431485 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000431485
Domain Number - Region: 79-116
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0196
Family Mitotic arrest deficient-like 1, Mad1 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000431485   Gene: ENSG00000100503   Transcript: ENST00000485005
Sequence length 140
Comment pep:known chromosome:GRCh38:14:50727689:50739388:-1 gene:ENSG00000100503 transcript:ENST00000485005 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
QLLWQENERLQTMVQNTKAELTHSREKVRQLESNLLPKHQKHLNPSGTMNPTEQEKLSLK
RECDQFQKEQSPANRKVSQMNSLEQELETIHLENEGLKKKQVKLDEQLMENSVVGSSREG
CSSLPEIVCEDAAPEVHCDA
Download sequence
Identical sequences A0A0B4J215
ENSP00000431485 ENSP00000431485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]