SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000431584 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000431584
Domain Number - Region: 41-139
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00693
Family Multidrug resistance efflux transporter EmrE 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000431584   Gene: ENSG00000134490   Transcript: ENST00000473688
Sequence length 159
Comment pep:known chromosome:GRCh38:18:23296017:23437961:-1 gene:ENSG00000134490 transcript:ENST00000473688 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MCVRRSLVGLTFCTCYLASYLTNKYVLSVLKFTYPTLFQGWQTLIGGLLLHVSWKLGWVE
INSSSRSHVLVWLPASVLFVGIIYAGSRALSRLAIPVFLTLHNVAEVIICGYQKCFQKEK
TSPAKICSALLLLAAAGCLPFNDSQGLIKFYRSPRNPVH
Download sequence
Identical sequences ENSP00000431584 ENSP00000431584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]