SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000432301 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000432301
Domain Number 1 Region: 91-247
Classification Level Classification E-value
Superfamily PH domain-like 3.75e-48
Family Pleckstrin-homology domain (PH domain) 0.00000222
Further Details:      
 
Domain Number 2 Region: 8-106
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-26
Family DBL homology domain (DH-domain) 0.0000314
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000432301   Gene: ENSG00000136002   Transcript: ENST00000532720
Sequence length 287
Comment pep:putative chromosome:GRCh38:2:131041277:131045558:1 gene:ENSG00000136002 transcript:ENST00000532720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XACVELSRLTKLSKYVYFFEACRLLQKMIDISLDGFLLTPVQKICKYPLQLAELLKYTHP
QHRDFKDVEAALHAMKNVAQLINERKRRLENIDKIAQWQSSIEDWEGEDLLVRSSELIYS
GELTRVTQPQAKSQQRMFFLFDHQLIYCKKDLLRRDVLYYKGRLDMDGLEVVDLEDGKDR
DLHVSIKNAFRLHRGATGDSHLLCTRKPEQKQRWLKAFAREREQVQLDQETGFSITELQR
KQAMLNASKQQVTGKPKGRRTAAPPPRLPGPYPADIIPFSEPQSQAS
Download sequence
Identical sequences H0YCT6
ENSP00000432301 ENSP00000432301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]