SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000432395 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000432395
Domain Number 1 Region: 18-53
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.00000000213
Family VPS28 N-terminal domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000432395   Gene: ENSG00000160948   Transcript: ENST00000530790
Sequence length 53
Comment pep:novel chromosome:GRCh38:8:144425718:144428544:-1 gene:ENSG00000160948 transcript:ENST00000530790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALE
Download sequence
Identical sequences A0A2J8PXF0 A0A2J8RHS5 E9PR04
ENSP00000432395 ENSP00000432395 ENSP00000454772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]