SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000432540 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000432540
Domain Number 1 Region: 187-391
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.77e-51
Family DBL homology domain (DH-domain) 0.000000297
Further Details:      
 
Domain Number 2 Region: 2-225
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.36e-38
Family Calponin-homology domain, CH-domain 0.0056
Further Details:      
 
Domain Number 3 Region: 378-540
Classification Level Classification E-value
Superfamily PH domain-like 1.78e-32
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 
Domain Number 4 Region: 637-766
Classification Level Classification E-value
Superfamily SH2 domain 2.91e-27
Family SH2 domain 0.00058
Further Details:      
 
Domain Number 5 Region: 803-873
Classification Level Classification E-value
Superfamily SH3-domain 1.12e-22
Family SH3-domain 0.00071
Further Details:      
 
Domain Number 6 Region: 587-665
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000856
Family SH3-domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000432540   Gene: ENSG00000134215   Transcript: ENST00000527011
Sequence length 875
Comment pep:novel chromosome:GRCh38:1:107571589:107965009:-1 gene:ENSG00000134215 transcript:ENST00000527011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPWKQCAQWLIHCKVLPTNHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLRAHSINLKEI
NLRPQMSQFLCLKNIRTFLTACCETFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTPI
ALATGIRPFPTEESINDEDIYKGLPDLIDETLVEDEEDLYDCVYGEDEGGEVYEDLMKAE
EAHQPKCPENDIRSCCLAEIKQTEEKYTETLESIEKYFMAPLKRFLTAAEFDSVFINIPE
LVKLHRNLMQEIHDSIVNKNDQNLYQVFINYKERLVIYGQYCSGVESAISSLDYISKTKE
DVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTTDPTEKANLKLALDA
MKDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLLFGRPQGDGEIRITTLDKHTKQER
HIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKENKKWSYGFYLIHTQGQNGL
EFYCKTKDLKKKWLEQFEMALSNIRPDYADSNFHDFKMHTFTRVTSCKVCQMLLRGTFYQ
GYLCFKCGARAHKECLGRVDNCGRVNSGEQGTLKLPEKRTNGLRRTPKQVDPGLPKMQVI
RNYSGTPPPALHEGPPLQLQAGDTVELLKGDAHSLFWQGRNLASGEVGFFPSDAVKPCPC
VPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIK
ILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEHSAGQRGNRA
GNSSPSLFCGFSFVTPPDYSFVPPSSTPFWSVLSPKVLGIAIARYDFCARDMRELSLLKG
DVVKIYTKMSANGWWRGEVNGRVGWFPSTYVEEDE
Download sequence
Identical sequences ENSP00000432540 ENSP00000431544 ENSP00000432540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]