SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000432787 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000432787
Domain Number - Region: 6-37
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0105
Family RILP dimerisation region 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000432787   Gene: ENSG00000111907   Transcript: ENST00000524679
Sequence length 102
Comment pep:known chromosome:GRCh38:6:125219845:125263148:1 gene:ENSG00000111907 transcript:ENST00000524679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSKSWHD
MQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMRRK
Download sequence
Identical sequences A0A1D5R6U0 A0A2I2YPJ0 A0A2I3HJZ9 A0A2J8RYY2 A0A2K5K4R4 A0A2K6MXC5
HR4879A NP_001278955.1.87134 NP_001278955.1.92137 NP_001305836.1.87134 NP_001305836.1.92137 XP_006879042.1.29581 XP_008951196.1.60992 XP_008993236.1.60252 XP_008993237.1.60252 XP_009240490.1.23681 XP_009240491.1.23681 XP_010341264.1.74449 XP_011712308.1.29376 XP_011799858.1.43180 XP_011799860.1.43180 XP_012331141.1.9421 XP_012361533.1.23891 XP_012361534.1.23891 XP_012361536.1.23891 XP_014992809.1.72884 XP_015303865.1.63531 XP_016866729.1.92137 XP_017388859.1.71028 XP_017718519.1.44346 XP_017718521.1.44346 XP_018885288.1.27298 XP_018885289.1.27298 ENSP00000376273 ENSP00000432590 ENSP00000432787 ENSP00000376273 ENSP00000432590 ENSP00000432787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]