SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000432806 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000432806
Domain Number - Region: 6-37
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00654
Family RILP dimerisation region 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000432806   Gene: ENSG00000111907   Transcript: ENST00000534368
Sequence length 92
Comment pep:known chromosome:GRCh38:6:125119049:125248360:1 gene:ENSG00000111907 transcript:ENST00000534368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSKSWHD
MQTTTAYKKTHETLSHAGQKATAAFSNVGTAI
Download sequence
Identical sequences A0A2J8RYX7 E9PNQ9
ENSP00000432806 ENSP00000432806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]