SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000432847 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000432847
Domain Number 1 Region: 59-152
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.35e-20
Family Protein kinases, catalytic subunit 0.0000909
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000432847   Gene: ENSG00000175634   Transcript: ENST00000528964
Sequence length 154
Comment pep:known chromosome:GRCh38:11:67428504:67435344:1 gene:ENSG00000175634 transcript:ENST00000528964 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVNVGPE
RIGPHCFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAKDTAHTRAER
NILESVKHPFIVELAYAFQTGGKLYLILECLSVD
Download sequence
Identical sequences ENSP00000432847 ENSP00000442949 ENSP00000432847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]