SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000433130 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000433130
Domain Number 1 Region: 79-300
Classification Level Classification E-value
Superfamily DNA-glycosylase 3.61e-67
Family Mismatch glycosylase 0.0000282
Further Details:      
 
Domain Number 2 Region: 345-484
Classification Level Classification E-value
Superfamily Nudix 1.04e-29
Family MutY C-terminal domain-like 0.000000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000433130   Gene: ENSG00000132781   Transcript: ENST00000528013
Sequence length 535
Comment pep:novel chromosome:GRCh38:1:45329306:45339946:-1 gene:ENSG00000132781 transcript:ENST00000528013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKPRAAVGSGHRKQAASQEGRQKHAKNNSQAKPSACDACAGMIAECPGAPAGLARQPEE
VVLQASVSSYHLFRDVAEVTAFRGSLLSWYDQEKRDLPWRRRAEDEMDLDRRAYAVWVSE
VMLQQTQVATVINYYTGWMQKWPTLQDLASASLEEVNQLWAGLGYYSRGRRLQEGARKVV
EELGGHMPRTAETLQQLLPGVGRYTAGAIASIAFGQATGVVDGNVARVLCRVRAIGADPS
STLVSQQLWGLAQQLVDPARPGDFNQAAMELGATVCTPQRPLCSQCPVESLCRARQRVEQ
EQLLASGSLSGSPDVEECAPNTGQCHLCLPPSEPWDQTLGVVNFPRKASRKPPREESSAT
CVLEQPGALGAQILLVQRPNSGLLAGLWEFPSVTWEPSEQLQRKALLQELQRWAGPLPAT
HLRHLGEVVHTFSHIKLTYQVYGLALEGQTPVTTVPPGARWLTQEEFHTAAVSTAMKKVF
RVYQGQQPGTCMGSKRSQVSSPCSRKKPRMGQQVLDNFFRSHISTDAHSLNSAAQ
Download sequence
Identical sequences E9PM53
ENSP00000433130 ENSP00000433130 XP_011539800.1.92137 XP_011539801.1.92137 XP_011539802.1.92137 XP_011539803.1.92137 XP_011539804.1.92137 XP_016856820.1.92137 XP_016856821.1.92137 XP_016856822.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]