SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000433135 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000433135
Domain Number 1 Region: 81-151
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000113
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.06
Further Details:      
 
Weak hits

Sequence:  ENSP00000433135
Domain Number - Region: 10-49
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000858
Family HLH, helix-loop-helix DNA-binding domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000433135   Gene: ENSG00000174576   Transcript: ENST00000525148
Sequence length 234
Comment pep:known chromosome:GRCh38:11:66421091:66426055:1 gene:ENSG00000174576 transcript:ENST00000525148 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MYRSTKGASKARRDQINAEIRNLKELLPLAEADKVRLSYLHIMSLACIYTRKGVFFAGGT
PLAGPTGLLSAQELEDIVAALPGFLLVFTAEGKLLYLSESVSEHLGHSMVDLVAQGDSIY
DIIDPADHLTVRQQLTLPSALDTDRLFRCRFNTSKSLRRQSAGNKLVLIRGRFHAHPPGA
YWAGNPVFTAFCAPLEPRPRPGPGPGPGPASLFLAMFQSRHAKDLALLDISESG
Download sequence
Identical sequences A0A2I2Z545 A0A2I3LPX6 A0A2I3T7Y5 A0A2J8U001 A0A2K5JBW3 A0A2K5LGH8 A0A2K5TZE7 A0A2K5Z7N7 A0A2K6BKH6 A0A2K6MNY6 A0A2K6PF09
ENSP00000433135 ENSP00000433135 XP_016873028.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]