SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000433245 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000433245
Domain Number 1 Region: 2-85
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 9.42e-19
Family NadC N-terminal domain-like 0.024
Further Details:      
 
Domain Number 2 Region: 64-127
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 0.000000000451
Family NadC C-terminal domain-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000433245   Gene: ENSG00000147813   Transcript: ENST00000532645
Sequence length 128
Comment pep:known chromosome:GRCh38:8:143575623:143578158:-1 gene:ENSG00000147813 transcript:ENST00000532645 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XALAAGLRDCVRFLRAFRLRDADVQFLASVLPPDTDPAFFEHLRALDCSEVPLLQVSGPL
LVVQLLETPLLCLVSYASLVATNAARLRLIAGPEKRLLEMGLRRAQGPDGGLTASTYSYL
GDVGASSW
Download sequence
Identical sequences H0YDA6
ENSP00000433245 ENSP00000433245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]