SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000433417 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000433417
Domain Number 1 Region: 166-328,370-539
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.13e-44
Family WD40-repeat 0.0042
Further Details:      
 
Domain Number 2 Region: 506-652
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000000487
Family Quinoprotein alcohol dehydrogenase-like 0.045
Further Details:      
 
Domain Number 3 Region: 35-220
Classification Level Classification E-value
Superfamily Peptidase/esterase 'gauge' domain 0.00000000011
Family Acylamino-acid-releasing enzyme, N-terminal donain 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000433417   Gene: ENSG00000149499   Transcript: ENST00000531557
Sequence length 679
Comment pep:putative chromosome:GRCh38:11:62602220:62611007:-1 gene:ENSG00000149499 transcript:ENST00000531557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLRGRPITMYIPSGIRSLEELPSGPPPETLSLDWVYGYRGRDSRSNLFVLRSGEVVYFI
ACVVVLYRPGGGPGGPGGGGQRHYRGHTDCVRCLAVHPDGVRVASGQTAGVDKDGKPLQP
VVHIWDSETLLKLQEIGLGAFERGVGALAFSAADQGAFLCVVDDSNEHMLSVWDCSRGMK
LAEIKSTNDSVLAVGFNPRDSSCIVTSGKSHVHFWNWSGGVGVPGNGTLTRKQGVFGKYK
KPKFIPCFVFLPDGDILTGDSEGNILTWGRSPSDSKTPGRGGAKETYGIVAQAHAHEGSI
FALCLRRDGTVLSGGGRDRRLVQWGPGLVALQEAEIPEHFGAVRAIAEGLGSELLVGTTK
NALLRGDLAQGFSPVIQGHTDELWGLCTHPSQNRFLTCGHDRQLCLWDGESHALAWSIDL
KETGLCADFHPSGAVVAVGLNTGRWLVLDTETREIVSDVIDGNEQLSVVRYSPDGLYLAI
GSHDNVIYIYSVSSDGAKSSRFGRCMGHSSFITHLDWSKDGNFIMSNSGDYEILYWDVAG
GCKQLKNRYESRDREWATYTCVLGFHVYGVWPDGSDGTDINSLCRSHNERVVAVADDFCK
VHLFQYPCARAKAPSRMYGGHGSHVTSVRFTHDDSHLVSLGGKDASIFQWRVLGAGGAGP
APATPSRTPSLSPASSLDV
Download sequence
Identical sequences A0A2I3S381 A0A2J8TXU4 G3V195
ENSP00000433417 ENSP00000433417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]