SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000433718 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000433718
Domain Number 1 Region: 6-147
Classification Level Classification E-value
Superfamily ALDH-like 1.19e-44
Family ALDH-like 0.00000937
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000433718   Gene: ENSG00000132746   Transcript: ENST00000525827
Sequence length 148
Comment pep:known chromosome:GRCh38:11:67665548:67674731:-1 gene:ENSG00000132746 transcript:ENST00000525827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDEPRSTNLFMKLDSVFIWKEPFGLVLIIAPWNYPLNLTLVLLVGALAAGSCVVLKPSE
ISQGTEKVLAEVLPQYLDQSCFAVVLGGPQETGQLLEHKLDYIFFTGSPRVGKIVMTAAT
KHLTPVTLELGGKNPCYVDDNCDPQTVA
Download sequence
Identical sequences ENSP00000433718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]