SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000433873 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000433873
Domain Number 1 Region: 2-85
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.61e-17
Family Phosphate binding protein-like 0.00000686
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000433873   Gene: ENSG00000152578   Transcript: ENST00000525942
Sequence length 104
Comment pep:known chromosome:GRCh38:11:105933808:105974430:1 gene:ENSG00000152578 transcript:ENST00000525942 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRNAVNL
AVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKNSCKPCRFETQ
Download sequence
Identical sequences H0YDL4
ENSP00000433873 ENSP00000433873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]