SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000433900 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000433900
Domain Number 1 Region: 27-191
Classification Level Classification E-value
Superfamily CutC-like 2.22e-63
Family CutC-like 0.00000714
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000433900   Gene: ENSG00000119929   Transcript: ENST00000471520
Sequence length 194
Comment pep:known chromosome:GRCh38:10:99732281:99755708:1 gene:ENSG00000119929 transcript:ENST00000471520 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MKRQGASSERKRARIPSGKAGAANGFLMEVCVDSVESAVNAERGGADRIELCSGLSEGGT
TPSMGVLQVVKQSVQIPVFVMIRPRGGDFLYSDREIEVMKADIRLAKLYGADGLVFGALT
EDGHIDKELCMSLMAICRPLPVTFHRAFDMVHDPMAALETLLTLGFERVLTSGCDSSALE
GLPLIKRLIEQEVV
Download sequence
Identical sequences A0A0B4J226 A0A2J8PDH1
ENSP00000433900 ENSP00000433900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]