SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000433907 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000433907
Domain Number 1 Region: 339-579
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.93e-67
Family Eukaryotic proteases 0.00000000224
Further Details:      
 
Domain Number 2 Region: 103-197
Classification Level Classification E-value
Superfamily Kringle-like 2.66e-32
Family Kringle modules 0.00000771
Further Details:      
 
Domain Number 3 Region: 209-297
Classification Level Classification E-value
Superfamily Kringle-like 4.59e-27
Family Kringle modules 0.00000612
Further Details:      
 
Domain Number 4 Region: 43-104
Classification Level Classification E-value
Superfamily GLA-domain 7.23e-20
Family GLA-domain 0.0000777
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000433907   Gene: ENSG00000180210   Transcript: ENST00000530231
Sequence length 583
Comment pep:novel chromosome:GRCh38:11:46719231:46739500:1 gene:ENSG00000180210 transcript:ENST00000530231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQARSLLQRVRRANTFLEEVRKGNLEREC
VEETCSYEEAFEALESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGTNYRGHV
NITRSGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYTTDPTVRRQE
CSIPVCGQDQVTVAMTPRSEGSSVNLSPPLEQCVPDRGQQYQGRLAVTTHGLPCLAWASA
QAKALSKHQDFNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFGYCDLNYCEEAVEEETG
DGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKKSLEDKTERELLESYI
DGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTEN
DLLVRIGKHSRTRYERNIEKISMLEKIYIHPSLLQAGYKGRVTGWGNLKETWTANVGKGQ
PSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFN
NRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQFGE
Download sequence
Identical sequences E9PIT3
ENSP00000433907 ENSP00000433907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]