SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000433923 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000433923
Domain Number 1 Region: 29-87
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 5.59e-18
Family Acyl-CoA thioesterase 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000433923   Gene: ENSG00000101473   Transcript: ENST00000486165
Sequence length 132
Comment pep:known chromosome:GRCh38:20:45844263:45857371:-1 gene:ENSG00000101473 transcript:ENST00000486165 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MSSPQAPEDGQGCGDRGDPPGDLRSVLVTTVLNLEPLDEDLFRGRHYWVPAKRLFGGQIV
GQALVAAAKSVSEDVHVHSLHCYFVRAEQMPSCVLRRSPAEKSLWTFTGTRSCQYCTKWS
GHEQGRASRCAL
Download sequence
Identical sequences E9PIS4
ENSP00000433923 ENSP00000433923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]