SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000434001 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000434001
Domain Number 1 Region: 7-97
Classification Level Classification E-value
Superfamily ApaG-like 7.19e-31
Family ApaG-like 0.00041
Further Details:      
 
Weak hits

Sequence:  ENSP00000434001
Domain Number - Region: 106-138
Classification Level Classification E-value
Superfamily ARM repeat 0.00432
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000434001   Gene: ENSG00000110429   Transcript: ENST00000532057
Sequence length 158
Comment pep:putative chromosome:GRCh38:11:33741739:33753399:-1 gene:ENSG00000110429 transcript:ENST00000532057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVGEFPIISPGRVYEYTSCTTFSTTS
GYMEGYYTFHFLYFKDKIFNVAIPRFHMACPTFRVSIARLEMGPDEYEEMEEEEEEEEEE
DEDDDSADMDESDEDDEEERRRRVFDVPIRRRRCSRLF
Download sequence
Identical sequences A0A2J8P3U0 A0A2J8WG20 Q49AF1
ENSP00000434001 ENSP00000435165 ENSP00000434001 ENSP00000435165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]