SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000434062 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000434062
Domain Number 1 Region: 27-60
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.000011
Family DBL homology domain (DH-domain) 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000434062   Gene: ENSG00000139132   Transcript: ENST00000494977
Sequence length 65
Comment pep:known chromosome:GRCh38:12:32582379:32644751:1 gene:ENSG00000139132 transcript:ENST00000494977 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XAETETKVQERENGESPLELEQLDQHHEMKETNEQKLHKIANELLLTERAYVNRLDLLDQ
KIEWR
Download sequence
Identical sequences H0YDQ0
ENSP00000434062 ENSP00000434062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]