SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000434064 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000434064
Domain Number 1 Region: 125-219
Classification Level Classification E-value
Superfamily VPS28 C-terminal domain-like 1.31e-35
Family VPS28 C-terminal domain-like 0.00033
Further Details:      
 
Domain Number 2 Region: 18-112
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 1.28e-33
Family VPS28 N-terminal domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000434064   Gene: ENSG00000160948   Transcript: ENST00000526054
Sequence length 221
Comment pep:known chromosome:GRCh38:8:144423617:144426983:-1 gene:ENSG00000160948 transcript:ENST00000526054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDC
VSPSEYTAACSRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKD
DKGNLNRCIADVVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTV
SQWLQTLSGMSASDELDDSQVRQMLFDLESAYNAFNRFLHA
Download sequence
Identical sequences A0A2K5S831 A0A2K6SUJ0 G3SD56 K7CGH9 Q548N1 Q9UK41 U3EZY3
ENSP00000292510 ENSP00000434064 NP_057292.1.87134 NP_057292.1.92137 XP_003819469.1.60992 XP_010328151.1.74449 XP_010328152.1.74449 XP_016815627.1.37143 XP_017367171.1.71028 XP_017367172.1.71028 XP_018887733.1.27298 gi|7705885|ref|NP_057292.1| GO.36858 HR193 hss001000249.1 hss001000249.2 Hs7705885___KOG3284 ENSP00000292510 ENSP00000434064 ENSP00000457919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]