SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000434069 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000434069
Domain Number - Region: 6-36
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 0.000175
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000434069   Gene: ENSG00000167325   Transcript: ENST00000533349
Sequence length 37
Comment pep:known chromosome:GRCh38:11:4094843:4138875:1 gene:ENSG00000167325 transcript:ENST00000533349 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MHVIKRDGRQERVMFDKITSRIQKLCYGLNMDFVDPM
Download sequence
Identical sequences A0A2J8ITU7 A0A2J8R1W3 E9PRY9
ENSP00000434069 ENSP00000434069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]