SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000434281 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000434281
Domain Number 1 Region: 216-261
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.0000458
Family Leucine zipper domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000434281   Gene: ENSG00000137504   Transcript: ENST00000490820
Sequence length 354
Comment pep:known chromosome:GRCh38:11:85659708:85665102:-1 gene:ENSG00000137504 transcript:ENST00000490820 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MRHSLTKLLAASGSNSPTRSESPEPAATCSLPSDLTRAAAGEEETAAAGSPGRKQQFGDE
GELEAGRGSRGGVAVRAPSPEEMEEEAIASLPGEETEDMDFLSGLELADLLDPRQPDWHL
DPGLSSPGPLSSSGGGSDSGGLWRGDDDDEAAAAEMQRFSDLLQRLLNGIGGCSSSSDSG
SAEKRRRKSPGGGGGGGSGNDNNQAATKSPRKAAAAAARLNRLKKKEYVMGLESRVRGLA
AENQELRAENRELGKRVQALQEESRYLRAVLANETGLARLLSRLSGVGLRLTTSLFRDSP
AGDHDYALPVGKQKQDLLEEDDSAGGVCLHVDKDKVSVEFCSACARKASSSLKM
Download sequence
Identical sequences Q9NS37
ENSP00000433459 ENSP00000434281 ENSGGOP00000006791 NP_001034707.1.87134 NP_001034707.1.92137 XP_011543497.1.92137 XP_016873577.1.92137 XP_016873578.1.92137 XP_016873579.1.92137 XP_016873580.1.92137 XP_016873581.1.92137 XP_018892911.1.27298 XP_018892912.1.27298 XP_018892913.1.27298 ENSP00000433459 ENSP00000434281 9606.ENSP00000260058 gi|88900495|ref|NP_001034707.1| ENSGGOP00000006791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]