SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000434393 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000434393
Domain Number 1 Region: 18-112
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 5.56e-34
Family VPS28 N-terminal domain 0.0028
Further Details:      
 
Domain Number 2 Region: 125-161
Classification Level Classification E-value
Superfamily VPS28 C-terminal domain-like 0.00000000000575
Family VPS28 C-terminal domain-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000434393   Gene: ENSG00000160948   Transcript: ENST00000531032
Sequence length 161
Comment pep:putative chromosome:GRCh38:8:144424105:144428543:-1 gene:ENSG00000160948 transcript:ENST00000531032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDC
VSPSEYTAACSRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKD
DKGNLNRCIADVVSLFITVMDKLRLEIRAMDEIQPDLRELM
Download sequence
Identical sequences A0A2J8PXG8 A0A2J8RHS4 E9PQR7
ENSP00000434393 ENSP00000434393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]