SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000434685 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000434685
Domain Number 1 Region: 4-372
Classification Level Classification E-value
Superfamily ALDH-like 3.14e-116
Family ALDH-like 0.0000000000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000434685   Gene: ENSG00000108602   Transcript: ENST00000468746
Sequence length 396
Comment pep:known chromosome:GRCh38:17:19737984:19748341:-1 gene:ENSG00000108602 transcript:ENST00000468746 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MSKISEAVKRARAAFSSGRTRPLQFRIQQLEALQRLIQEQEQELVGALAADLHKNEWNAY
YEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYIHSEPLGVVLVIGTWNYPFNL
TIQPMVGAIAAGNSVVLKPSELSENMASLLATIIPQYLDKDLYPVINGGVPETTELLKER
FDHILYTGSTGVGKIIMTAAAKHLTPVTLELGGKSPCYVDKNCDLDVACRRIAWGKFMNS
GQTCVAPDYILCDPSIQNQIVEKLKKSLKEFYGEDAKKSRDYGRIISARHFQRVMGLIEG
QKVAYGGTGDAATRYIAPTILTDVDPQSPVMQEEIFGPVLPIVCVRSLEEAIQFINQREK
PLALYMFSSNDKGTAAWDPTMARRASRLSLTAALAW
Download sequence
Identical sequences E9PNN6
ENSP00000434685 ENSP00000434685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]