SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000435099 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000435099
Domain Number 1 Region: 60-183
Classification Level Classification E-value
Superfamily 4'-phosphopantetheinyl transferase 1.01e-23
Family 4'-Phosphopantetheinyl transferase SFP 0.014
Further Details:      
 
Domain Number 2 Region: 2-52
Classification Level Classification E-value
Superfamily 4'-phosphopantetheinyl transferase 0.000000000000144
Family 4'-Phosphopantetheinyl transferase SFP 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000435099   Gene: ENSG00000149313   Transcript: ENST00000524411
Sequence length 190
Comment pep:putative chromosome:GRCh38:11:106076242:106094654:1 gene:ENSG00000149313 transcript:ENST00000524411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIRKLVAEKLNIPWNHIRLQRTAKGKPVLAKDSSNPYPNFNFNISHQGDYAVLAAEPELQ
VGIDIMKTSFPGRGSIPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIK
AIGVGLGFELQRLEFDLSPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVAL
RKPDGSRHQD
Download sequence
Identical sequences A0A2J8LBW7 A0A2J8XXE4 E9PLW6
ENSP00000435099 ENSP00000435099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]