SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000435268 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000435268
Domain Number 1 Region: 22-80
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.01e-24
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 2 Region: 120-150
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000298
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000435268   Gene: ENSG00000245680   Transcript: ENST00000527838
Sequence length 157
Comment pep:putative chromosome:GRCh38:19:37184822:37210484:-1 gene:ENSG00000245680 transcript:ENST00000527838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPASWTSPQKSSALAPEDHGSSYEGSVSFRDVAIDFSREEWRHLDLSQRNLYRDVMLETY
SHLLSVGYQVPKPEVVMLEQGKEPWALQGERPRHSCPGEKLWDHNQHRKIIGYKPASSQD
QKIYSGEKSYECAEFGKSFTWKSQFKASQNSYRRKTI
Download sequence
Identical sequences F2Z3L4
ENSP00000435268 ENSP00000435268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]