SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000435280 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000435280
Domain Number 1 Region: 22-87
Classification Level Classification E-value
Superfamily Carbonic anhydrase 0.00000000000000105
Family Carbonic anhydrase 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000435280   Gene: ENSG00000131686   Transcript: ENST00000480186
Sequence length 179
Comment pep:putative chromosome:GRCh38:1:8945882:8952651:1 gene:ENSG00000131686 transcript:ENST00000480186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYN
PSLKGLNMTGYETQAGEFPMVNNGHTDWQAELFLPSLSSPCGEGAKHKGQRQWLCSPSLD
SWWEAIIDGGSLWATLAECGLRAEGPEEGRHMEEKSPASQGACSGSRLPISRGPCTFFL
Download sequence
Identical sequences Q8N4G4
ENSP00000435280 ENSP00000435280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]