SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000435447 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000435447
Domain Number - Region: 6-36
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0353
Family RILP dimerisation region 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000435447   Gene: ENSG00000111907   Transcript: ENST00000532429
Sequence length 175
Comment pep:known chromosome:GRCh38:6:125154189:125263044:1 gene:ENSG00000111907 transcript:ENST00000532429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSKSWHD
MQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPAMRNSPTFKS
FEERVETTVTSLKTKVGGTNPNGGSFEEVLSSTAHASAQSLAGGSRRTKEEELQC
Download sequence
Identical sequences A0A2K5XE53 F7DFW5
gi|51173744|ref|NP_001003395.1| ENSP00000435447 ENSP00000435447 NP_001003395.1.87134 NP_001003395.1.92137 XP_003255709.1.23891 XP_003827659.1.60992 XP_004044683.1.27298 XP_005267179.1.92137 XP_011847559.1.47321 XP_011887044.1.92194 XP_017718515.1.44346 ENSMMUP00000004191 9544.ENSMMUP00000004191 ENSMMUP00000004191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]