SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000435476 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000435476
Domain Number 1 Region: 3-64
Classification Level Classification E-value
Superfamily ALDH-like 0.00000000000000223
Family ALDH-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000435476   Gene: ENSG00000132746   Transcript: ENST00000531248
Sequence length 128
Comment pep:putative chromosome:GRCh38:11:67663067:67665301:-1 gene:ENSG00000132746 transcript:ENST00000531248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSDRYIAPTVLVDVQETEPVMQEEIFGPILPIVNVQSVDEAIKFINRQEKPLALPQWDGP
VPRQVHLRHLLPPPHLPARPLRPGEIKGDPLPTLYRLEPAAVTLGHGLPELHPPVSVPPA
SNGSHRET
Download sequence
Identical sequences H0YEC0
ENSP00000435476 ENSP00000435476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]