SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000435584 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000435584
Domain Number 1 Region: 37-94
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 0.000000000000288
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.0000353
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000435584   Gene: ENSG00000117054   Transcript: ENST00000534334
Sequence length 104
Comment pep:known chromosome:GRCh38:1:75724767:75761248:1 gene:ENSG00000117054 transcript:ENST00000534334 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQATARKFAREEI
IPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCANAYYYCWK
Download sequence
Identical sequences A0A2I2YSX4 E9PJM9
ENSP00000435584 ENSP00000435584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]