SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000435822 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000435822
Domain Number - Region: 88-119
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.0155
Family Papain-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000435822   Gene: ENSG00000174080   Transcript: ENST00000526010
Sequence length 120
Comment pep:putative chromosome:GRCh38:11:66566375:66568841:-1 gene:ENSG00000174080 transcript:ENST00000526010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCRLPVSKKTLLCSFQVLDELGRHVLLRKDCGPVDTKVPGAGEPKSAFTQGSAMISSLS
QNHPDNRNETFSSVISLLNEDPLSQDLPVKMASIFKNFVITYNRTYESKEEARWRLSVFV
Download sequence
Identical sequences E9PSC2
ENSP00000435822 ENSP00000435822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]