SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000436393 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000436393
Domain Number 1 Region: 19-122
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.87e-18
Family PLC-like (P variant) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000436393   Gene: ENSG00000078902   Transcript: ENST00000530506
Sequence length 179
Comment pep:known chromosome:GRCh38:11:1276817:1309583:-1 gene:ENSG00000078902 transcript:ENST00000530506 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MATTVSTQRGPAKLAKNYGMTRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIHCTVPP
GVDSFYLEIFDERAFSMDDRIAWTHITIPESLRQGKVEDKWYSLSGRQGDDKEGMINLVM
SYALLPAAMVMPPQPVVLMPTVYQQGVGYVPITDIVNFGTAPHFIEKFPRRCRNICQSL
Download sequence
Identical sequences A0A2J8JVI6 E9PP67
ENSP00000436393 ENSP00000436393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]