SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000436442 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000436442
Domain Number 1 Region: 2-85
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.77e-20
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000436442   Gene: ENSG00000133794   Transcript: ENST00000524392
Sequence length 171
Comment pep:known chromosome:GRCh38:11:13374093:13387266:1 gene:ENSG00000133794 transcript:ENST00000524392 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
RATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFIT
LRSRWFSFMNPWTKEVEYIVSTNTVVLSRVDTGHLGQVEWCTVLSRPDSRFLIAGMFTEP
TSWKAGTQPSHSSQHPPTAWTACCPLEKVAQRGPTPLFQGFQGEPGLGQEK
Download sequence
Identical sequences H0YER9
ENSP00000436442 ENSP00000436442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]