SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000436466 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000436466
Domain Number 1 Region: 293-388
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000907
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0046
Further Details:      
 
Domain Number 2 Region: 122-183
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000484
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.069
Further Details:      
 
Domain Number 3 Region: 37-78
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000995
Family HLH, helix-loop-helix DNA-binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000436466   Gene: ENSG00000106546   Transcript: ENST00000463496
Sequence length 848
Comment pep:known chromosome:GRCh38:7:17298683:17346152:1 gene:ENSG00000106546 transcript:ENST00000463496 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MNSSSANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDV
INKLDKLSVLRLSVSYLRAKSFFDVALKSSPTERNGGQDNCRAANFREGLNLQEGEFLLQ
ALNGFVLVVTTDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNP
SQCTESGQGIEEATGLPQTVVCYNPDQIPPENSPLMERCFICRLRCLLDNSSGFLAMNFQ
GKLKYLHGQKKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGC
DAKGRIVLGYTEAELCTRGSGYQFIHAADMLYCAESHIRMIKTGESGMIVFRLLTKNNRW
TWVQSNARLLYKNGRPDYIIVTQRPLTDEEGTEHLRKRNTKLPFMFTTGEAVLYEATNPF
PAIMDPLPLRTKNGTSGKDSATTSTLSKDSLNPSSLLAAMMQQDESIYLYPASSTSSTAP
FENNFFNESMNECRNWQDNTAPMGNDTILKHEQIDQPQDVNSFAGGHPGLFQDSKNSDLY
SIMKNLGIDFEDIRHMQNEKFFRNDFSGEVDFRDIDLTDEILTYVQDSLSKSPFIPSDYQ
QQQSLALNSSCMVQEHLHLEQQQQHHQKQVVVEPQQQLCQKMKHMQVNGMFENWNSNQFV
PFNCPQQDPQQYNVFTDLHGISQEFPYKSEMDSMPYTQNFISCNQPVLPQHSKCTELDYP
MGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEPQH
THVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHHPSEARPFP
DLTSSGFL
Download sequence
Identical sequences A0A024R9Z8 P35869
ENSP00000242057 ENSP00000436466 HR4425 9606.ENSP00000242057 NP_001612.1.87134 NP_001612.1.92137 gi|4502003|ref|NP_001612.1| ENSP00000242057 ENSP00000436466 ENSP00000242057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]