SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000436519 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000436519
Domain Number 1 Region: 10-182
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-40
Family DBL homology domain (DH-domain) 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000436519   Gene: ENSG00000137135   Transcript: ENST00000475323
Sequence length 186
Comment pep:known chromosome:GRCh38:9:35658877:35665192:-1 gene:ENSG00000137135 transcript:ENST00000475323 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MELSCPGSRCPVQEQRARWERKRACTARELLETERRYQEQLGLVATYFLGILKAKGTLRP
PERQALFGSWELIYGASQELLPYLEGGCWGQGLEGFCRHLELYNQFAANSERSQTTLQEQ
LKKNKGFRRFVRLQEGRPEFGGLQLQDLLPLPLQRLQQYENLVVALAENTGPNSPDHQQL
TPVLPS
Download sequence
Identical sequences ENSP00000436519 ENSP00000344922 ENSP00000436519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]