SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000436928 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000436928
Domain Number - Region: 2-11
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00165
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 141-167
Classification Level Classification E-value
Superfamily PUG domain-like 0.0549
Family PUG domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000436928   Gene: ENSG00000066855   Transcript: ENST00000527155
Sequence length 185
Comment pep:putative chromosome:GRCh38:8:65707053:65771252:1 gene:ENSG00000066855 transcript:ENST00000527155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XPPPPPPLPPPALGLHQSTSAVDLIKERREKRANAGKTLVKNNPKKPEMPNMLEILKEMN
SVKLRSVKRSEQDVKPKPVDATDPAALIAEALKKKFAYRYRSDSQDEVEKGIPKSESEAT
SERVLKRLVKVRTCWTRRPMANPTEDKFISLKRIRTMTKTIQTTIIHGRKYCGIYIIKWL
RSFFC
Download sequence
Identical sequences H0YF01
ENSP00000436928 ENSP00000436928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]