SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000437102 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000437102
Domain Number 1 Region: 5-120
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 6.18e-29
Family NadC N-terminal domain-like 0.0016
Further Details:      
 
Domain Number 2 Region: 99-162
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 0.000000000785
Family NadC C-terminal domain-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000437102   Gene: ENSG00000147813   Transcript: ENST00000525583
Sequence length 163
Comment pep:known chromosome:GRCh38:8:143575432:143578218:-1 gene:ENSG00000147813 transcript:ENST00000525583 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XARDAAEFELFFRRCPFGGAFALAAGLRDCVRFLRAFRLRDADVQFLASVLPPDTDPAFF
EHLRALDCSEVTVRALPEGSLAFPGVPLLQVSGPLLVVQLLETPLLCLVSYASLVATNAA
RLRLIAGPEKRLLEMGLRRAQGPDGGLTASTYSYLGDVGASSW
Download sequence
Identical sequences H0YF31
ENSP00000437102 ENSP00000437102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]