SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000437161 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000437161
Domain Number 1 Region: 1-133
Classification Level Classification E-value
Superfamily ALDH-like 5.5e-36
Family ALDH-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000437161   Gene: ENSG00000118514   Transcript: ENST00000460753
Sequence length 134
Comment pep:novel chromosome:GRCh38:6:134918530:134929161:-1 gene:ENSG00000118514 transcript:ENST00000460753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EFLKRFVEATRKWKVGIPSDPLVRSYVKRALAEGAQIWCGEGVDKLSLPARNQAGYFMLP
TVITDIKDESCCMTEEIFGPVTCVVPFDSEEEVIERANNVKYGLAATVWSSNVGRVHRVA
KKLQSGLVWTNCWL
Download sequence
Identical sequences A0A2J8PT05 H0YF40
ENSP00000437161 ENSP00000437161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]