SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000437510 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000437510
Domain Number - Region: 29-65
Classification Level Classification E-value
Superfamily TPR-like 0.037
Family Tetratricopeptide repeat (TPR) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000437510   Gene: ENSG00000131779   Transcript: ENST00000537888
Sequence length 245
Comment pep:known chromosome:GRCh38:1:145911351:145918529:-1 gene:ENSG00000131779 transcript:ENST00000537888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKLRAAQYACSLLGHALQRHGASPELQKQIRQLESHLSLGRKLLRLGNSADALESAKRA
VHLSDVVLRFCITVSHLNRALYFACDNVLWAGKSGLAPRVDQEKWAQRSFRYYLFSLIMN
LSRDAYEIRLLMEQESSACSRRLKGSGGGVPGGSETGGLGGPGTPGGGLPQLALKLRLQV
LLLARVLRGHPPLLLDVVRNACDLFIPLDKLGLWRCGPGIVGLCGLVSSILSILTLIYPW
LRLKP
Download sequence
Identical sequences H2PZU0
ENSP00000437510 ENSPTRP00000002052 ENSP00000437510 ENSP00000464199 NP_001171724.1.87134 NP_001171724.1.92137 gi|296317239|ref|NP_001171724.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]