SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000438330 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000438330
Domain Number - Region: 6-39
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.0366
Family Transducin (heterotrimeric G protein), gamma chain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000438330   Gene: ENSG00000108587   Transcript: ENST00000537788
Sequence length 81
Comment pep:known chromosome:GRCh38:17:30477423:30490191:1 gene:ENSG00000108587 transcript:ENST00000537788 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAAGTSSYWEDLRKQARQLENELDLKLVSFSKLCTSYSHSSTRDGRRDRYRKNYLENISQ
EILPQTETGFVELLQPNSPSK
Download sequence
Identical sequences A0A2I2ZA84 F6RU00
ENSP00000438330 ENSP00000438330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]