SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000438424 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000438424
Domain Number 1 Region: 19-217
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.75e-70
Family Phosphate binding protein-like 0.00000519
Further Details:      
 
Domain Number 2 Region: 218-257,291-312
Classification Level Classification E-value
Superfamily Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.000000000497
Family Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000438424   Gene: ENSG00000256269   Transcript: ENST00000544387
Sequence length 321
Comment pep:novel chromosome:GRCh38:11:119084914:119093548:1 gene:ENSG00000256269 transcript:ENST00000544387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGNGNAAATAEENSPKMRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTG
DKILDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPH
DAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLDEQ
QEFSAIILATAGLQRMGWHNRVGQILHPEECMYAVGQEGGCSVPVAVHTAMKDGQLYLTG
GVWSLDGSDSIQETMQATIHVPAQHEDGPEDDPQLVGITARNIPRGPQLAAQNLGISLAN
LLLSKGAKNILDVARQLNDAH
Download sequence
Identical sequences A0A2I2ZEW9 A0A2I3S533
NP_001245137.1.87134 NP_001245137.1.92137 ENSP00000438424 ENSP00000461361 ENSP00000438424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]