SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000438726 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000438726
Domain Number 1 Region: 19-119
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.85e-31
Family Phosphate binding protein-like 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000438726   Gene: ENSG00000256269   Transcript: ENST00000536813
Sequence length 119
Comment pep:novel chromosome:GRCh38:11:119084885:119090021:1 gene:ENSG00000256269 transcript:ENST00000536813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGNGNAAATAEENSPKMRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIRDKILDT
ALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVF
Download sequence
Identical sequences F5H0P4
ENSP00000438726 ENSP00000438726 ENSP00000458751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]