SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000438749 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000438749
Domain Number 1 Region: 29-102
Classification Level Classification E-value
Superfamily FKBP-like 3.73e-24
Family FKBP immunophilin/proline isomerase 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000438749   Gene: ENSG00000173486   Transcript: ENST00000535135
Sequence length 102
Comment pep:known chromosome:GRCh38:11:64241666:64243472:1 gene:ENSG00000173486 transcript:ENST00000535135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKL
EDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKR
Download sequence
Identical sequences F5H0N4
ENSP00000438749 ENSP00000438749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]