SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000439142 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000439142
Domain Number 1 Region: 28-170
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.65e-43
Family Ubiquitin thiolesterase protein OTUB2 (Otubain-2) 0.0000195
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000439142   Gene: ENSG00000167770   Transcript: ENST00000541478
Sequence length 170
Comment pep:putative chromosome:GRCh38:11:63985997:63998376:1 gene:ENSG00000167770 transcript:ENST00000541478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEEPQQQKQEPLGSDSEGVNCLAYDEAIMAQQDRIQQEFMDLIEQVEKQTSVADLLAS
FNDQSTSDYLVVYLRLLTSGYLQRESKFFEHFIEGGRTVKEFCQQEVEPMCKESDHIHII
ALAQALSVSIQVEYMDRGEGGTTNPHIFPEGSEPKVYLLYRPGHYDILYK
Download sequence
Identical sequences A0A1D5Q3K5 A0A2I3MXL8 A0A2I3SG73 A0A2K5C9E4 A0A2K5MK05 A0A2K5RLQ3 A0A2K5U6T1 A0A2K5ZSG7 A0A2K6DPR9 A0A2K6MWB1 A0A2K6R7B8 A0A2K6SFD5 F5H3F0
ENSP00000439142 ENSP00000439142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]