SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000439298 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000439298
Domain Number - Region: 10-49
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00977
Family Tandem AAA-ATPase domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000439298   Gene: ENSG00000013573   Transcript: ENST00000543756
Sequence length 78
Comment pep:known chromosome:GRCh38:12:31073909:31085068:1 gene:ENSG00000013573 transcript:ENST00000543756 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MANETQKVGAIHFPFPFTPYSIQEDFMAELYRVLEAGKIGIFESPTGTGLQAPRGLLENR
PGLLSLCRRKKRGTWWTD
Download sequence
Identical sequences F5H2V9
ENSP00000439298 ENSP00000439298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]