SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000439342 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000439342
Domain Number 1 Region: 99-188
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 3.92e-18
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00000616
Further Details:      
 
Domain Number 2 Region: 46-97
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000919
Family TS-N domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000439342   Gene: ENSG00000123297   Transcript: ENST00000543727
Sequence length 215
Comment pep:known chromosome:GRCh38:12:57782745:57802631:1 gene:ENSG00000123297 transcript:ENST00000543727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLLRSLRVFLVARTGSYPAGSLLRQSPQPRHTFYAGPRLSASASSKELLMKLRRKTGYS
FVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKAAKLQGRKTKEGLIGLLQEGNTTVLVE
VNCETDFVSRNLKFQLLVQQVALGTMMHCQTLKDQPSAYSKGFLNSSELSGLPAGPDREG
SLKDQLALAIGLPFQIGAVSELQLPESNFLQNTSS
Download sequence
Identical sequences ENSP00000439342 gi|291084502|ref|NP_001166168.1| ENSP00000439342 NP_001166168.1.87134 NP_001166168.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]